PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133606.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 892aa    MW: 98482.5 Da    PI: 5.4279
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133606.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK901.9e-28575625252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek++sl++l+++Fs+++kdAAk+Lgvc+T+LKr CRq+GI+RWP+Rki+++
  XP_009133606.1 575 EKNVSLSVLQQHFSGSLKDAAKSLGVCPTTLKRXCRQHGIMRWPSRKINKV 625
                     89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.586564645IPR003035RWP-RK domain
PfamPF020421.1E-26577625IPR003035RWP-RK domain
SuperFamilySSF542771.77E-23782877No hitNo description
Gene3DG3DSA:3.10.20.2405.0E-25790871No hitNo description
SMARTSM006661.0E-25792874IPR000270PB1 domain
PROSITE profilePS5174523.437792874IPR000270PB1 domain
CDDcd064078.01E-36793873No hitNo description
PfamPF005641.8E-18793873IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
MEHPFASRDK VFGYQDISTE EMDSFSFGSG VRSLISDDMF NSSSNSELVN FDSFSTWCNS  60
PSVSDVLFAQ YGLSTSQSMP FGAITSAHAP ELRAATLPGL TRSFHDMESS YYGEERPSLQ  120
EMISQFDHSL DSVQLSGKRR RVANQKNGFP NLMNCTIPRS LSHSLDEKML KALSLFLESS  180
GSGEGILAQV WTPIKIGDQH VLSTCDQAYL LDPRLSQYRE VSRKFTFASE ANQCSFPGLP  240
GRVFISGVPE WTSNVVYYKT DEYLRMKHAI DNEVRGSIAI PILEASGTTC CAVMELVTSK  300
EKPNFDTEMD SVCRALQAVN LRTSASPRPQ FLSSNQRDAL AEIQDVLRAV CHAHRLPLAL  360
AWIPCSYGKG GKNQSGVLCV EETACYVNDT EMEGFVHVCL EHCLREKEGI VGRAFVSNKP  420
LFSSDVKAYD ISEYPLVQHA RKYGLNAAVA IKLRSTYTGE DDYILELFLP VSMKGSLEQQ  480
LLLDSLSGTM QRICRTLRTV SDIGEAKKEV SKTGVLTACS GNFQTMLSDS ELNSTRNIFS  540
DMSSDKDSSG TGSQGTYEQD MSKARTPEKK KSTTEKNVSL SVLQQHFSGS LKDAAKSLGV  600
CPTTLKRXCR QHGIMRWPSR KINKVNRSLR KIQTVLDSVQ GVEGGLKFDS TTGEFVAVCP  660
FIKELDTQKD PVRGQEDTAQ DTSFELLEAK SVDNAIKLEE DIIANGSFVE VDASGQQWAW  720
MAEQSGFNGN LSSQAIRCSG SINEPNQSMS CSMSGSSNGS GAVMLRSSST SMDDSNQVRT  780
QKSNSSESGS TTLTVKATYR EDTIRFKFEP SLGCSQLYKE VRKRFKLQEE SFQLKYLDDE  840
EEWVMLVTDS DLQECLEILY GMGKHTVKFL VRDLPAPIGS SAGSNCYLGT GL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137141KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133606.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP8-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM4C7X90.0M4C7X9_BRARP; Uncharacterized protein
STRINGBra000307.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein